PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00124914001
Common NameGSBRNA2T00124914001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 215aa    MW: 22929 Da    PI: 9.8174
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00124914001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.3e-3971130362
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GG+lrnvPvGgg r+n++++
  GSBRNA2T00124914001  71 EAALKCPRCESTNTKFCYFNNYSLTQPRHFCKSCRRYWTRGGSLRNVPVGGGYRRNRHTK 130
                          7789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3458128IPR003851Zinc finger, Dof-type
PfamPF027012.1E-3273128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.96674128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MVFSSIQAYL DSSNWQQAPP SNHNQGGAGA SDTGGHGVFP QPQSNSSGGS GSIRPGSMVD  60
RARQANVAMP EAALKCPRCE STNTKFCYFN NYSLTQPRHF CKSCRRYWTR GGSLRNVPVG  120
GGYRRNRHTK SSSNNNSTAT SNNTSFTSAA SGNASTISAI LSSNYGGNHE SILSQILYPG  180
RFSSVKGEDN PYKWVNVNGN CSSWIDLSTF GSSS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00124914001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893071e-127AC189307.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB033O04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627183.11e-103PREDICTED: dof zinc finger protein DOF2.4-like
SwissprotO809283e-81DOF24_ARATH; Dof zinc finger protein DOF2.4
TrEMBLA0A078F3261e-156A0A078F326_BRANA; BnaA03g17300D protein
STRINGBra000008.1-P1e-101(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113541732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-64DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]